Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 9,865
  2. Avatar for toshiue 2. toshiue Lv 1 83 pts. 9,864
  3. Avatar for Hollinas 3. Hollinas Lv 1 69 pts. 9,863
  4. Avatar for ZeroLeak7 4. ZeroLeak7 Lv 1 56 pts. 9,862
  5. Avatar for Maerlyn138 5. Maerlyn138 Lv 1 45 pts. 9,858
  6. Avatar for pauldunn 6. pauldunn Lv 1 36 pts. 9,857
  7. Avatar for LociOiling 7. LociOiling Lv 1 29 pts. 9,848
  8. Avatar for smilingone 8. smilingone Lv 1 23 pts. 9,847
  9. Avatar for reefyrob 9. reefyrob Lv 1 18 pts. 9,841
  10. Avatar for dbuske 10. dbuske Lv 1 14 pts. 9,836

Comments