1489: Revisiting Puzzle 52: Bacteria Energy
Closed since about 8 years ago
Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction PredictionSummary
- Created
- February 28, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA