Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 9,862
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 9,845
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 94 pts. 9,820
  4. Avatar for Enzyme 4. Enzyme Lv 1 91 pts. 9,820
  5. Avatar for frood66 5. frood66 Lv 1 88 pts. 9,778
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 86 pts. 9,772
  7. Avatar for eusair 7. eusair Lv 1 83 pts. 9,768
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 80 pts. 9,746
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 78 pts. 9,706
  10. Avatar for fiendish_ghoul 10. fiendish_ghoul Lv 1 75 pts. 9,698

Comments