Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for gstelle 91. gstelle Lv 1 2 pts. 9,097
  2. Avatar for Deleted player 92. Deleted player pts. 9,087
  3. Avatar for Altercomp 93. Altercomp Lv 1 2 pts. 9,069
  4. Avatar for ComputerMage 94. ComputerMage Lv 1 2 pts. 9,067
  5. Avatar for CallMeHarb 95. CallMeHarb Lv 1 2 pts. 9,066
  6. Avatar for Hollinas 96. Hollinas Lv 1 2 pts. 9,057
  7. Avatar for drumpeter18yrs9yrs 97. drumpeter18yrs9yrs Lv 1 1 pt. 9,050
  8. Avatar for kyky 98. kyky Lv 1 1 pt. 9,047
  9. Avatar for silent gene 99. silent gene Lv 1 1 pt. 9,041
  10. Avatar for abiogenesis 100. abiogenesis Lv 1 1 pt. 9,029

Comments