Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for Datstandin 101. Datstandin Lv 1 1 pt. 9,023
  2. Avatar for senor pit 102. senor pit Lv 1 1 pt. 9,016
  3. Avatar for bzipitidoo 103. bzipitidoo Lv 1 1 pt. 9,008
  4. Avatar for atlas100 104. atlas100 Lv 1 1 pt. 9,004
  5. Avatar for antibot215 105. antibot215 Lv 1 1 pt. 9,004
  6. Avatar for maximiliancarey 106. maximiliancarey Lv 1 1 pt. 8,986
  7. Avatar for rinze 107. rinze Lv 1 1 pt. 8,984
  8. Avatar for multaq 108. multaq Lv 1 1 pt. 8,971
  9. Avatar for roman madala 109. roman madala Lv 1 1 pt. 8,969
  10. Avatar for RootBeerSwordsman 110. RootBeerSwordsman Lv 1 1 pt. 8,967

Comments