Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for Superintelligence 131. Superintelligence Lv 1 1 pt. 8,779
  2. Avatar for Noodle Soup 132. Noodle Soup Lv 1 1 pt. 8,766
  3. Avatar for jbmkfm125 133. jbmkfm125 Lv 1 1 pt. 8,761
  4. Avatar for calgone 134. calgone Lv 1 1 pt. 8,725
  5. Avatar for Anton Trikshev 135. Anton Trikshev Lv 1 1 pt. 8,703
  6. Avatar for pllq 136. pllq Lv 1 1 pt. 8,695
  7. Avatar for ealytim 137. ealytim Lv 1 1 pt. 8,685
  8. Avatar for kimsejin5 138. kimsejin5 Lv 1 1 pt. 8,645
  9. Avatar for mcdonmic 139. mcdonmic Lv 1 1 pt. 8,638
  10. Avatar for alyssajoyh 140. alyssajoyh Lv 1 1 pt. 8,618

Comments