Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834

  1. Avatar for Deleted player 151. Deleted player pts. 5,936
  2. Avatar for altejoh 152. altejoh Lv 1 1 pt. 1,675
  3. Avatar for PiotrJ1337 153. PiotrJ1337 Lv 1 1 pt. 0
  4. Avatar for llberrey 154. llberrey Lv 1 1 pt. 0
  5. Avatar for Susume 155. Susume Lv 1 1 pt. 0
  6. Avatar for fmk499 156. fmk499 Lv 1 1 pt. 0
  7. Avatar for tokens 157. tokens Lv 1 1 pt. 0
  8. Avatar for emtonsti 159. emtonsti Lv 1 1 pt. 0

Comments