Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for O Seki To 21. O Seki To Lv 1 51 pts. 9,613
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 50 pts. 9,587
  3. Avatar for dizzywings 23. dizzywings Lv 1 48 pts. 9,587
  4. Avatar for nicobul 24. nicobul Lv 1 46 pts. 9,584
  5. Avatar for pvc78 25. pvc78 Lv 1 44 pts. 9,577
  6. Avatar for Vinara 26. Vinara Lv 1 43 pts. 9,568
  7. Avatar for ViJay7019 27. ViJay7019 Lv 1 41 pts. 9,560
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 40 pts. 9,555
  9. Avatar for jobo0502 29. jobo0502 Lv 1 38 pts. 9,550
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 37 pts. 9,546

Comments