Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for guineapig 31. guineapig Lv 1 35 pts. 9,543
  2. Avatar for Madde 32. Madde Lv 1 34 pts. 9,542
  3. Avatar for bertro 33. bertro Lv 1 33 pts. 9,539
  4. Avatar for drjr 34. drjr Lv 1 31 pts. 9,534
  5. Avatar for YeshuaLives 35. YeshuaLives Lv 1 30 pts. 9,519
  6. Avatar for Deleted player 36. Deleted player pts. 9,518
  7. Avatar for Threeoak 37. Threeoak Lv 1 28 pts. 9,516
  8. Avatar for smilingone 38. smilingone Lv 1 27 pts. 9,512
  9. Avatar for Jim Fraser 39. Jim Fraser Lv 1 26 pts. 9,500
  10. Avatar for Alistair69 40. Alistair69 Lv 1 25 pts. 9,490

Comments