Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,962
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834
  6. Avatar for Eastern Prehistoric Force 16. Eastern Prehistoric Force 1 pt. 8,801
  1. Avatar for Vincera 61. Vincera Lv 1 10 pts. 9,260
  2. Avatar for pfirth 62. pfirth Lv 1 9 pts. 9,257
  3. Avatar for phi16 63. phi16 Lv 1 9 pts. 9,254
  4. Avatar for what could possibly go wrong 64. what could possibly go wrong Lv 1 8 pts. 9,252
  5. Avatar for @lison 65. @lison Lv 1 8 pts. 9,242
  6. Avatar for tomespen 66. tomespen Lv 1 8 pts. 9,232
  7. Avatar for PaulusMa 67. PaulusMa Lv 1 7 pts. 9,228
  8. Avatar for mitarcher 68. mitarcher Lv 1 7 pts. 9,224
  9. Avatar for harvardman 69. harvardman Lv 1 6 pts. 9,217
  10. Avatar for SouperGenious 70. SouperGenious Lv 1 6 pts. 9,216

Comments