Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 9,069
  2. Avatar for Russian team 12. Russian team 1 pt. 9,067
  3. Avatar for Alpha Rays 13. Alpha Rays 1 pt. 8,986
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,834

  1. Avatar for benrh 81. benrh Lv 1 3 pts. 9,152
  2. Avatar for bcre8tvv 82. bcre8tvv Lv 1 3 pts. 9,141
  3. Avatar for momadoc 83. momadoc Lv 1 3 pts. 9,136
  4. Avatar for SaraL 84. SaraL Lv 1 3 pts. 9,119
  5. Avatar for Psych0Active 85. Psych0Active Lv 1 3 pts. 9,116
  6. Avatar for rabamino12358 86. rabamino12358 Lv 1 3 pts. 9,115
  7. Avatar for cocl2 87. cocl2 Lv 1 2 pts. 9,109
  8. Avatar for Arne Heessels 88. Arne Heessels Lv 1 2 pts. 9,107
  9. Avatar for fishercat 89. fishercat Lv 1 2 pts. 9,105
  10. Avatar for Maerlyn138 90. Maerlyn138 Lv 1 2 pts. 9,099

Comments