Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181
  1. Avatar for phi16 21. phi16 Lv 1 1 pt. 9,590
  2. Avatar for ViJay7019 22. ViJay7019 Lv 1 1 pt. 9,574
  3. Avatar for isaksson 23. isaksson Lv 1 1 pt. 9,448
  4. Avatar for lamoille 24. lamoille Lv 1 1 pt. 9,374
  5. Avatar for alcor29 25. alcor29 Lv 1 1 pt. 9,367
  6. Avatar for Sporeo 26. Sporeo Lv 1 1 pt. 9,326
  7. Avatar for atlas100 27. atlas100 Lv 1 1 pt. 9,284
  8. Avatar for harvardman 28. harvardman Lv 1 1 pt. 8,957

Comments