1495: Revisiting Puzzle 55: Scorpion Toxin
Closed since about 8 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- March 13, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH