Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  5. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  6. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  7. Avatar for Window Group 18. Window Group 1 pt. 4,116

  1. Avatar for Alexei2511 111. Alexei2511 Lv 1 1 pt. 8,172
  2. Avatar for frostschutz 112. frostschutz Lv 1 1 pt. 8,165
  3. Avatar for kyky 113. kyky Lv 1 1 pt. 8,156
  4. Avatar for Pauling 114. Pauling Lv 1 1 pt. 8,088
  5. Avatar for west.elsdon 115. west.elsdon Lv 1 1 pt. 8,011
  6. Avatar for exploren 116. exploren Lv 1 1 pt. 7,840
  7. Avatar for atlas100 117. atlas100 Lv 1 1 pt. 7,828
  8. Avatar for Sydefecks 118. Sydefecks Lv 1 1 pt. 7,825
  9. Avatar for NotJim99 119. NotJim99 Lv 1 1 pt. 7,818
  10. Avatar for bzipitidoo 120. bzipitidoo Lv 1 1 pt. 7,813

Comments