Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for freefolder 11. freefolder 2 pts. 9,070
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,839
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,652
  4. Avatar for Eastern Prehistoric Force 14. Eastern Prehistoric Force 1 pt. 8,424
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,767
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 7,660
  7. Avatar for Coastal Biochemistry 17. Coastal Biochemistry 1 pt. 7,217
  8. Avatar for Window Group 18. Window Group 1 pt. 4,116
  1. Avatar for Vinara 31. Vinara Lv 1 36 pts. 10,102
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 35 pts. 10,089
  3. Avatar for jobo0502 33. jobo0502 Lv 1 34 pts. 10,069
  4. Avatar for drjr 34. drjr Lv 1 33 pts. 10,044
  5. Avatar for johnmitch 35. johnmitch Lv 1 31 pts. 10,009
  6. Avatar for smilingone 36. smilingone Lv 1 30 pts. 9,968
  7. Avatar for Deleted player 37. Deleted player pts. 9,956
  8. Avatar for Tehnologik1 38. Tehnologik1 Lv 1 28 pts. 9,949
  9. Avatar for DoctorSockrates 39. DoctorSockrates Lv 1 27 pts. 9,921
  10. Avatar for Idiotboy 40. Idiotboy Lv 1 26 pts. 9,887

Comments