Placeholder image of a protein
Icon representing a puzzle

1495: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,707
  2. Avatar for Go Science 2. Go Science 74 pts. 10,647
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 10,603
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 10,542
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 10,430
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 18 pts. 10,347
  7. Avatar for Contenders 7. Contenders 12 pts. 10,335
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 10,317
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,156
  10. Avatar for Deleted group 10. Deleted group pts. 9,146
  1. Avatar for Vinara 31. Vinara Lv 1 36 pts. 10,102
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 35 pts. 10,089
  3. Avatar for jobo0502 33. jobo0502 Lv 1 34 pts. 10,069
  4. Avatar for drjr 34. drjr Lv 1 33 pts. 10,044
  5. Avatar for johnmitch 35. johnmitch Lv 1 31 pts. 10,009
  6. Avatar for smilingone 36. smilingone Lv 1 30 pts. 9,968
  7. Avatar for Deleted player 37. Deleted player pts. 9,956
  8. Avatar for Tehnologik1 38. Tehnologik1 Lv 1 28 pts. 9,949
  9. Avatar for DoctorSockrates 39. DoctorSockrates Lv 1 27 pts. 9,921
  10. Avatar for Idiotboy 40. Idiotboy Lv 1 26 pts. 9,887

Comments