1498: Revisiting Puzzle 57: Beta-Neurotoxin
Closed since almost 8 years ago
Intermediate Overall PredictionSummary
- Created
- March 19, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC
