1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 8 years ago

Summary

• Created: March 19, 2018
• Expires: March 26, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

• 1. Gargleblasters 100 pts. 10,558
• 2. Anthropic Dreams 73 pts. 10,510
• 3. Void Crushers 52 pts. 10,508
• 4. Beta Folders 36 pts. 10,454
• 5. L'Alliance Francophone 24 pts. 10,417
• 6. Marvin's bunch 16 pts. 10,361
• 7. Go Science 10 pts. 10,342
• 8. Contenders 6 pts. 10,246
• 9. HMT heritage 4 pts. 9,860
• 10. Russian team 2 pts. 9,398

Top soloists

• 1. eusair 100 pts. 10,711
• 2. Deleted player pts. 10,655
• 3. Enzyme 94 pts. 10,556
• 4. Timo van der Laan 90 pts. 10,508
• 5. Galaxie 87 pts. 10,504
• 6. fiendish_ghoul 84 pts. 10,496
• 7. bertro 81 pts. 10,454
• 8. dcrwheeler 78 pts. 10,438
• 9. LociOiling 75 pts. 10,437
• 10. reefyrob 72 pts. 10,417