Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0

  1. Avatar for momadoc 91. momadoc Lv 1 1 pt. 8,605
  2. Avatar for Mike Cassidy 92. Mike Cassidy Lv 1 1 pt. 8,603
  3. Avatar for NotJim99 93. NotJim99 Lv 1 1 pt. 8,600
  4. Avatar for Gahmeir 94. Gahmeir Lv 1 1 pt. 8,599
  5. Avatar for MasterMatthew 95. MasterMatthew Lv 1 1 pt. 8,523
  6. Avatar for ViJay7019 96. ViJay7019 Lv 1 1 pt. 8,486
  7. Avatar for Altercomp 97. Altercomp Lv 1 1 pt. 8,460
  8. Avatar for antibot215 98. antibot215 Lv 1 1 pt. 8,449
  9. Avatar for The_Otterable 99. The_Otterable Lv 1 1 pt. 8,396
  10. Avatar for lamoille 100. lamoille Lv 1 1 pt. 8,383

Comments