Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0
  1. Avatar for Superphosphate 111. Superphosphate Lv 1 1 pt. 8,268
  2. Avatar for alcor29 112. alcor29 Lv 1 1 pt. 8,254
  3. Avatar for Lilitu 113. Lilitu Lv 1 1 pt. 8,219
  4. Avatar for karost 114. karost Lv 1 1 pt. 8,185
  5. Avatar for elizabethshedroff 115. elizabethshedroff Lv 1 1 pt. 8,166
  6. Avatar for lconor 116. lconor Lv 1 1 pt. 8,130
  7. Avatar for Sydefecks 117. Sydefecks Lv 1 1 pt. 8,100
  8. Avatar for jamiexq 118. jamiexq Lv 1 1 pt. 8,095
  9. Avatar for kimsejin5 119. kimsejin5 Lv 1 1 pt. 7,977
  10. Avatar for AJ1685 120. AJ1685 Lv 1 1 pt. 7,959

Comments