Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0
  1. Avatar for grogar7 11. grogar7 Lv 1 69 pts. 10,381
  2. Avatar for pvc78 12. pvc78 Lv 1 67 pts. 10,366
  3. Avatar for smilingone 13. smilingone Lv 1 64 pts. 10,355
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 62 pts. 10,347
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 59 pts. 10,346
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 57 pts. 10,341
  7. Avatar for frood66 17. frood66 Lv 1 55 pts. 10,315
  8. Avatar for actiasluna 18. actiasluna Lv 1 53 pts. 10,293
  9. Avatar for Blipperman 19. Blipperman Lv 1 50 pts. 10,279
  10. Avatar for RockOn 20. RockOn Lv 1 48 pts. 10,263

Comments