Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0

  1. Avatar for mitarcher 61. mitarcher Lv 1 6 pts. 9,334
  2. Avatar for Fat Tony 62. Fat Tony Lv 1 6 pts. 9,321
  3. Avatar for cobaltteal 63. cobaltteal Lv 1 6 pts. 9,285
  4. Avatar for Vincera 64. Vincera Lv 1 5 pts. 9,235
  5. Avatar for froggs554 65. froggs554 Lv 1 5 pts. 9,208
  6. Avatar for rezaefar 66. rezaefar Lv 1 5 pts. 9,158
  7. Avatar for dbuske 67. dbuske Lv 1 4 pts. 9,158
  8. Avatar for Sporeo 68. Sporeo Lv 1 4 pts. 9,150
  9. Avatar for hada 69. hada Lv 1 4 pts. 9,093
  10. Avatar for sciencewalker 70. sciencewalker Lv 1 4 pts. 9,089

Comments