Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0
  1. Avatar for kyky 71. kyky Lv 1 4 pts. 9,016
  2. Avatar for paul567croyden 72. paul567croyden Lv 1 3 pts. 9,004
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 3 pts. 8,997
  4. Avatar for fishercat 74. fishercat Lv 1 3 pts. 8,990
  5. Avatar for atlas100 75. atlas100 Lv 1 3 pts. 8,966
  6. Avatar for carsonfb 76. carsonfb Lv 1 3 pts. 8,964
  7. Avatar for SKSbell 77. SKSbell Lv 1 2 pts. 8,920
  8. Avatar for drjr 78. drjr Lv 1 2 pts. 8,906
  9. Avatar for leehaggis 79. leehaggis Lv 1 2 pts. 8,853
  10. Avatar for andrewxc 80. andrewxc Lv 1 2 pts. 8,830

Comments