Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for freefolder 11. freefolder 1 pt. 8,460
  2. Avatar for Deleted group 12. Deleted group pts. 8,396
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,373
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,350
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,272
  6. Avatar for Window Group 16. Window Group 1 pt. 0
  7. Avatar for test_group1 17. test_group1 1 pt. 0

  1. Avatar for Kenpachi 81. Kenpachi Lv 1 2 pts. 8,820
  2. Avatar for cherry39 82. cherry39 Lv 1 2 pts. 8,813
  3. Avatar for phi16 83. phi16 Lv 1 2 pts. 8,783
  4. Avatar for SouperGenious 84. SouperGenious Lv 1 2 pts. 8,743
  5. Avatar for MayPeda2018 85. MayPeda2018 Lv 1 1 pt. 8,739
  6. Avatar for Knoblerine 86. Knoblerine Lv 1 1 pt. 8,729
  7. Avatar for roman madala 87. roman madala Lv 1 1 pt. 8,662
  8. Avatar for Hollinas 88. Hollinas Lv 1 1 pt. 8,660
  9. Avatar for Arne Heessels 89. Arne Heessels Lv 1 1 pt. 8,646
  10. Avatar for Auntecedent 90. Auntecedent Lv 1 1 pt. 8,608

Comments