Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398

  1. Avatar for Superphosphate 111. Superphosphate Lv 1 1 pt. 8,268
  2. Avatar for alcor29 112. alcor29 Lv 1 1 pt. 8,254
  3. Avatar for Lilitu 113. Lilitu Lv 1 1 pt. 8,219
  4. Avatar for karost 114. karost Lv 1 1 pt. 8,185
  5. Avatar for elizabethshedroff 115. elizabethshedroff Lv 1 1 pt. 8,166
  6. Avatar for lconor 116. lconor Lv 1 1 pt. 8,130
  7. Avatar for Sydefecks 117. Sydefecks Lv 1 1 pt. 8,100
  8. Avatar for jamiexq 118. jamiexq Lv 1 1 pt. 8,095
  9. Avatar for kimsejin5 119. kimsejin5 Lv 1 1 pt. 7,977
  10. Avatar for AJ1685 120. AJ1685 Lv 1 1 pt. 7,959

Comments