Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398

  1. Avatar for grogar7 11. grogar7 Lv 1 69 pts. 10,381
  2. Avatar for pvc78 12. pvc78 Lv 1 67 pts. 10,366
  3. Avatar for smilingone 13. smilingone Lv 1 64 pts. 10,355
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 62 pts. 10,347
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 59 pts. 10,346
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 57 pts. 10,341
  7. Avatar for frood66 17. frood66 Lv 1 55 pts. 10,315
  8. Avatar for actiasluna 18. actiasluna Lv 1 53 pts. 10,293
  9. Avatar for Blipperman 19. Blipperman Lv 1 50 pts. 10,279
  10. Avatar for RockOn 20. RockOn Lv 1 48 pts. 10,263

Comments