Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398

  1. Avatar for Deleted player 31. Deleted player pts. 10,055
  2. Avatar for jobo0502 32. jobo0502 Lv 1 29 pts. 10,051
  3. Avatar for pauldunn 33. pauldunn Lv 1 28 pts. 10,050
  4. Avatar for NinjaGreg 34. NinjaGreg Lv 1 26 pts. 10,030
  5. Avatar for johnmitch 35. johnmitch Lv 1 25 pts. 9,992
  6. Avatar for katling 36. katling Lv 1 24 pts. 9,991
  7. Avatar for robgee 37. robgee Lv 1 23 pts. 9,975
  8. Avatar for isaksson 38. isaksson Lv 1 22 pts. 9,965
  9. Avatar for alwen 39. alwen Lv 1 21 pts. 9,958
  10. Avatar for caglar 40. caglar Lv 1 20 pts. 9,957

Comments