Placeholder image of a protein
Icon representing a puzzle

1498: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
March 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,558
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,510
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 10,508
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 10,454
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,417
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,361
  7. Avatar for Go Science 7. Go Science 10 pts. 10,342
  8. Avatar for Contenders 8. Contenders 6 pts. 10,246
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 9,860
  10. Avatar for Russian team 10. Russian team 2 pts. 9,398

  1. Avatar for Kenpachi 81. Kenpachi Lv 1 2 pts. 8,820
  2. Avatar for cherry39 82. cherry39 Lv 1 2 pts. 8,813
  3. Avatar for phi16 83. phi16 Lv 1 2 pts. 8,783
  4. Avatar for SouperGenious 84. SouperGenious Lv 1 2 pts. 8,743
  5. Avatar for MayPeda2018 85. MayPeda2018 Lv 1 1 pt. 8,739
  6. Avatar for Knoblerine 86. Knoblerine Lv 1 1 pt. 8,729
  7. Avatar for roman madala 87. roman madala Lv 1 1 pt. 8,662
  8. Avatar for Hollinas 88. Hollinas Lv 1 1 pt. 8,660
  9. Avatar for Arne Heessels 89. Arne Heessels Lv 1 1 pt. 8,646
  10. Avatar for Auntecedent 90. Auntecedent Lv 1 1 pt. 8,608

Comments