Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,853
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,637

  1. Avatar for Lilitu 101. Lilitu Lv 1 1 pt. 8,938
  2. Avatar for ViJay7019 102. ViJay7019 Lv 1 1 pt. 8,933
  3. Avatar for Deleted player 103. Deleted player pts. 8,929
  4. Avatar for mirjamvandelft 104. mirjamvandelft Lv 1 1 pt. 8,889
  5. Avatar for paul567croyden 105. paul567croyden Lv 1 1 pt. 8,880
  6. Avatar for Noodle Soup 106. Noodle Soup Lv 1 1 pt. 8,878
  7. Avatar for rabamino12358 107. rabamino12358 Lv 1 1 pt. 8,876
  8. Avatar for hys08111 108. hys08111 Lv 1 1 pt. 8,875
  9. Avatar for Madis731 109. Madis731 Lv 1 1 pt. 8,875
  10. Avatar for TheStaticSloth 110. TheStaticSloth Lv 1 1 pt. 8,874

Comments