Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023
  1. Avatar for Lilitu 101. Lilitu Lv 1 1 pt. 8,938
  2. Avatar for ViJay7019 102. ViJay7019 Lv 1 1 pt. 8,933
  3. Avatar for Deleted player 103. Deleted player pts. 8,929
  4. Avatar for mirjamvandelft 104. mirjamvandelft Lv 1 1 pt. 8,889
  5. Avatar for paul567croyden 105. paul567croyden Lv 1 1 pt. 8,880
  6. Avatar for Noodle Soup 106. Noodle Soup Lv 1 1 pt. 8,878
  7. Avatar for rabamino12358 107. rabamino12358 Lv 1 1 pt. 8,876
  8. Avatar for hys08111 108. hys08111 Lv 1 1 pt. 8,875
  9. Avatar for Madis731 109. Madis731 Lv 1 1 pt. 8,875
  10. Avatar for TheStaticSloth 110. TheStaticSloth Lv 1 1 pt. 8,874

Comments