Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,853
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,637
  1. Avatar for mitarcher 71. mitarcher Lv 1 4 pts. 9,280
  2. Avatar for tarimo 72. tarimo Lv 1 3 pts. 9,265
  3. Avatar for pandapharmd 73. pandapharmd Lv 1 3 pts. 9,246
  4. Avatar for jobo0502 74. jobo0502 Lv 1 3 pts. 9,229
  5. Avatar for ourtown 75. ourtown Lv 1 3 pts. 9,207
  6. Avatar for bcre8tvv 76. bcre8tvv Lv 1 3 pts. 9,206
  7. Avatar for jamiexq 77. jamiexq Lv 1 2 pts. 9,205
  8. Avatar for Poovent 78. Poovent Lv 1 2 pts. 9,205
  9. Avatar for anthion 79. anthion Lv 1 2 pts. 9,197
  10. Avatar for multaq 80. multaq Lv 1 2 pts. 9,193

Comments