Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023
  1. Avatar for mitarcher 71. mitarcher Lv 1 4 pts. 9,280
  2. Avatar for tarimo 72. tarimo Lv 1 3 pts. 9,265
  3. Avatar for pandapharmd 73. pandapharmd Lv 1 3 pts. 9,246
  4. Avatar for jobo0502 74. jobo0502 Lv 1 3 pts. 9,229
  5. Avatar for ourtown 75. ourtown Lv 1 3 pts. 9,207
  6. Avatar for bcre8tvv 76. bcre8tvv Lv 1 3 pts. 9,206
  7. Avatar for jamiexq 77. jamiexq Lv 1 2 pts. 9,205
  8. Avatar for Poovent 78. Poovent Lv 1 2 pts. 9,205
  9. Avatar for anthion 79. anthion Lv 1 2 pts. 9,197
  10. Avatar for multaq 80. multaq Lv 1 2 pts. 9,193

Comments