Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 11,220
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,921
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 10,694
  4. Avatar for incognito group 14. incognito group 1 pt. 10,571
  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 12,708
  2. Avatar for LociOiling 2. LociOiling Lv 1 83 pts. 12,706
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 68 pts. 12,671
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 55 pts. 12,635
  5. Avatar for pauldunn 5. pauldunn Lv 1 44 pts. 12,631
  6. Avatar for bertro 6. bertro Lv 1 35 pts. 12,625
  7. Avatar for toshiue 7. toshiue Lv 1 27 pts. 12,622
  8. Avatar for sciencewalker 8. sciencewalker Lv 1 21 pts. 12,619
  9. Avatar for Galaxie 9. Galaxie Lv 1 16 pts. 12,608
  10. Avatar for lamoille 10. lamoille Lv 1 12 pts. 12,590

Comments