Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,665
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 12,636
  3. Avatar for grogar7 3. grogar7 Lv 1 94 pts. 12,606
  4. Avatar for phi16 4. phi16 Lv 1 90 pts. 12,578
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 87 pts. 12,571
  6. Avatar for frood66 6. frood66 Lv 1 84 pts. 12,530
  7. Avatar for bertro 7. bertro Lv 1 81 pts. 12,519
  8. Avatar for AtOneMent 8. AtOneMent Lv 1 78 pts. 12,496
  9. Avatar for TastyMunchies 9. TastyMunchies Lv 1 75 pts. 12,453
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 72 pts. 12,449

Comments