Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 11,220
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,921
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 10,694
  4. Avatar for incognito group 14. incognito group 1 pt. 10,571
  1. Avatar for Ladybug_dk 91. Ladybug_dk Lv 1 1 pt. 11,306
  2. Avatar for ManVsYard 92. ManVsYard Lv 1 1 pt. 11,290
  3. Avatar for SouperGenious 93. SouperGenious Lv 1 1 pt. 11,272
  4. Avatar for abiogenesis 94. abiogenesis Lv 1 1 pt. 11,267
  5. Avatar for pfeiffelfloyd 95. pfeiffelfloyd Lv 1 1 pt. 11,247
  6. Avatar for Datstandin 96. Datstandin Lv 1 1 pt. 11,231
  7. Avatar for Mike Cassidy 97. Mike Cassidy Lv 1 1 pt. 11,226
  8. Avatar for Savas 98. Savas Lv 1 1 pt. 11,220
  9. Avatar for parsnip 99. parsnip Lv 1 1 pt. 11,175
  10. Avatar for KnaveErrant 100. KnaveErrant Lv 1 1 pt. 11,174

Comments