Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 11,220
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,921
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 10,694
  4. Avatar for incognito group 14. incognito group 1 pt. 10,571
  1. Avatar for Apolloid 131. Apolloid Lv 1 1 pt. 10,090
  2. Avatar for Vincera 132. Vincera Lv 1 1 pt. 9,820
  3. Avatar for Spartan021 133. Spartan021 Lv 1 1 pt. 9,486
  4. Avatar for 01010011111 134. 01010011111 Lv 1 1 pt. 8,058
  5. Avatar for ninja9 135. ninja9 Lv 1 1 pt. 6,345
  6. Avatar for joshmiller 136. joshmiller Lv 1 1 pt. 4,514
  7. Avatar for USA SciEng Festival 137. USA SciEng Festival Lv 1 1 pt. 4,514
  8. Avatar for chuotnhosiu 138. chuotnhosiu Lv 1 1 pt. 4,514
  9. Avatar for Bautho 139. Bautho Lv 1 1 pt. 4,514
  10. Avatar for xenos Su 140. xenos Su Lv 1 1 pt. 4,514

Comments