Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 11,220
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,921
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 10,694
  4. Avatar for incognito group 14. incognito group 1 pt. 10,571

  1. Avatar for O Seki To 31. O Seki To Lv 1 31 pts. 12,145
  2. Avatar for Susume 32. Susume Lv 1 29 pts. 12,140
  3. Avatar for nicobul 33. nicobul Lv 1 28 pts. 12,122
  4. Avatar for katling 34. katling Lv 1 27 pts. 12,089
  5. Avatar for YeshuaLives 35. YeshuaLives Lv 1 26 pts. 12,063
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 25 pts. 12,044
  7. Avatar for hpaege 37. hpaege Lv 1 23 pts. 12,002
  8. Avatar for Glen B 38. Glen B Lv 1 22 pts. 11,995
  9. Avatar for RockOn 39. RockOn Lv 1 21 pts. 11,994
  10. Avatar for jausmh 40. jausmh Lv 1 20 pts. 11,982

Comments