Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 11,220
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,921
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 10,694
  4. Avatar for incognito group 14. incognito group 1 pt. 10,571
  1. Avatar for Museka 51. Museka Lv 1 12 pts. 11,878
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 11 pts. 11,874
  3. Avatar for diamonddays 53. diamonddays Lv 1 11 pts. 11,871
  4. Avatar for Vinara 54. Vinara Lv 1 10 pts. 11,836
  5. Avatar for manu8170 55. manu8170 Lv 1 9 pts. 11,834
  6. Avatar for dbuske 56. dbuske Lv 1 9 pts. 11,790
  7. Avatar for FillmoreLove 57. FillmoreLove Lv 1 8 pts. 11,775
  8. Avatar for alcor29 58. alcor29 Lv 1 8 pts. 11,774
  9. Avatar for tarimo 59. tarimo Lv 1 8 pts. 11,739
  10. Avatar for xabxs 60. xabxs Lv 1 7 pts. 11,734

Comments