Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 11,220
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 10,921
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 10,694
  4. Avatar for incognito group 14. incognito group 1 pt. 10,571
  1. Avatar for multaq 61. multaq Lv 1 7 pts. 11,692
  2. Avatar for paul567croyden 62. paul567croyden Lv 1 6 pts. 11,690
  3. Avatar for jobo0502 63. jobo0502 Lv 1 6 pts. 11,689
  4. Avatar for SWR_DMaster 64. SWR_DMaster Lv 1 6 pts. 11,676
  5. Avatar for Deleted player 65. Deleted player pts. 11,676
  6. Avatar for rezaefar 66. rezaefar Lv 1 5 pts. 11,673
  7. Avatar for sciencewalker 67. sciencewalker Lv 1 5 pts. 11,668
  8. Avatar for cobaltteal 68. cobaltteal Lv 1 4 pts. 11,665
  9. Avatar for lconor 69. lconor Lv 1 4 pts. 11,654
  10. Avatar for heather-1 70. heather-1 Lv 1 4 pts. 11,647

Comments