Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646

  1. Avatar for alwen 41. alwen Lv 1 19 pts. 11,979
  2. Avatar for toshiue 42. toshiue Lv 1 18 pts. 11,944
  3. Avatar for altejoh 43. altejoh Lv 1 18 pts. 11,933
  4. Avatar for robgee 44. robgee Lv 1 17 pts. 11,931
  5. Avatar for Blipperman 45. Blipperman Lv 1 16 pts. 11,922
  6. Avatar for isaksson 46. isaksson Lv 1 15 pts. 11,919
  7. Avatar for erikviking 47. erikviking Lv 1 14 pts. 11,914
  8. Avatar for eusair 48. eusair Lv 1 14 pts. 11,914
  9. Avatar for guineapig 49. guineapig Lv 1 13 pts. 11,903
  10. Avatar for Fat Tony 50. Fat Tony Lv 1 12 pts. 11,902

Comments