Placeholder image of a protein
Icon representing a puzzle

1508: Revisiting Puzzle 60: Beta Barrel

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 15, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Beta Folders 100 pts. 12,708
  2. Avatar for Go Science 2. Go Science 68 pts. 12,636
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 12,608
  4. Avatar for Gargleblasters 4. Gargleblasters 27 pts. 12,544
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 12,530
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 12,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 12,307
  8. Avatar for Contenders 8. Contenders 3 pts. 12,257
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 12,145
  10. Avatar for Team China 10. Team China 1 pt. 11,646

  1. Avatar for Museka 51. Museka Lv 1 12 pts. 11,878
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 11 pts. 11,874
  3. Avatar for diamonddays 53. diamonddays Lv 1 11 pts. 11,871
  4. Avatar for Vinara 54. Vinara Lv 1 10 pts. 11,836
  5. Avatar for manu8170 55. manu8170 Lv 1 9 pts. 11,834
  6. Avatar for dbuske 56. dbuske Lv 1 9 pts. 11,790
  7. Avatar for FillmoreLove 57. FillmoreLove Lv 1 8 pts. 11,775
  8. Avatar for alcor29 58. alcor29 Lv 1 8 pts. 11,774
  9. Avatar for tarimo 59. tarimo Lv 1 8 pts. 11,739
  10. Avatar for xabxs 60. xabxs Lv 1 7 pts. 11,734

Comments