Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,680
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 10,650
  3. Avatar for grogar7 3. grogar7 Lv 1 93 pts. 10,641
  4. Avatar for eusair 4. eusair Lv 1 89 pts. 10,630
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 85 pts. 10,623
  6. Avatar for phi16 6. phi16 Lv 1 82 pts. 10,619
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 79 pts. 10,558
  8. Avatar for Enzyme 8. Enzyme Lv 1 75 pts. 10,522
  9. Avatar for LociOiling 9. LociOiling Lv 1 72 pts. 10,508
  10. Avatar for reefyrob 10. reefyrob Lv 1 69 pts. 10,490

Comments