1511: Unsolved De-novo Freestyle 129
Closed since almost 8 years ago
Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction PredictionSummary
- Created
- April 20, 2018
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE