Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886
  1. Avatar for Vinara 21. Vinara Lv 1 42 pts. 10,238
  2. Avatar for Madde 22. Madde Lv 1 40 pts. 10,238
  3. Avatar for drjr 23. drjr Lv 1 38 pts. 10,220
  4. Avatar for pvc78 24. pvc78 Lv 1 37 pts. 10,193
  5. Avatar for tarimo 25. tarimo Lv 1 35 pts. 10,166
  6. Avatar for isaksson 26. isaksson Lv 1 33 pts. 10,064
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 32 pts. 10,059
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 30 pts. 10,045
  9. Avatar for guineapig 29. guineapig Lv 1 29 pts. 10,032
  10. Avatar for Bautho 30. Bautho Lv 1 27 pts. 10,021

Comments