Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481
  1. Avatar for Vinara 21. Vinara Lv 1 42 pts. 10,238
  2. Avatar for Madde 22. Madde Lv 1 40 pts. 10,238
  3. Avatar for drjr 23. drjr Lv 1 38 pts. 10,220
  4. Avatar for pvc78 24. pvc78 Lv 1 37 pts. 10,193
  5. Avatar for tarimo 25. tarimo Lv 1 35 pts. 10,166
  6. Avatar for isaksson 26. isaksson Lv 1 33 pts. 10,064
  7. Avatar for dcrwheeler 27. dcrwheeler Lv 1 32 pts. 10,059
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 30 pts. 10,045
  9. Avatar for guineapig 29. guineapig Lv 1 29 pts. 10,032
  10. Avatar for Bautho 30. Bautho Lv 1 27 pts. 10,021

Comments