Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886

  1. Avatar for toshiue 51. toshiue Lv 1 8 pts. 9,587
  2. Avatar for AtOneMent 52. AtOneMent Lv 1 8 pts. 9,486
  3. Avatar for sciencewalker 53. sciencewalker Lv 1 7 pts. 9,482
  4. Avatar for jausmh 54. jausmh Lv 1 7 pts. 9,479
  5. Avatar for FillmoreLove 55. FillmoreLove Lv 1 6 pts. 9,470
  6. Avatar for silent gene 56. silent gene Lv 1 6 pts. 9,451
  7. Avatar for Merf 57. Merf Lv 1 6 pts. 9,410
  8. Avatar for fishercat 58. fishercat Lv 1 5 pts. 9,403
  9. Avatar for Marvelz 59. Marvelz Lv 1 5 pts. 9,366
  10. Avatar for Psych0Active 60. Psych0Active Lv 1 5 pts. 9,349

Comments