Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481

  1. Avatar for toshiue 51. toshiue Lv 1 8 pts. 9,587
  2. Avatar for AtOneMent 52. AtOneMent Lv 1 8 pts. 9,486
  3. Avatar for sciencewalker 53. sciencewalker Lv 1 7 pts. 9,482
  4. Avatar for jausmh 54. jausmh Lv 1 7 pts. 9,479
  5. Avatar for FillmoreLove 55. FillmoreLove Lv 1 6 pts. 9,470
  6. Avatar for silent gene 56. silent gene Lv 1 6 pts. 9,451
  7. Avatar for Merf 57. Merf Lv 1 6 pts. 9,410
  8. Avatar for fishercat 58. fishercat Lv 1 5 pts. 9,403
  9. Avatar for Marvelz 59. Marvelz Lv 1 5 pts. 9,366
  10. Avatar for Psych0Active 60. Psych0Active Lv 1 5 pts. 9,349

Comments