Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 8,188
  2. Avatar for Team China 12. Team China 1 pt. 7,143
  3. Avatar for Window Group 13. Window Group 1 pt. 4,886

  1. Avatar for Arne Heessels 71. Arne Heessels Lv 1 2 pts. 9,217
  2. Avatar for khendarg 72. khendarg Lv 1 2 pts. 9,211
  3. Avatar for SouperGenious 73. SouperGenious Lv 1 2 pts. 9,197
  4. Avatar for marsfan 74. marsfan Lv 1 2 pts. 9,195
  5. Avatar for mitarcher 75. mitarcher Lv 1 2 pts. 9,184
  6. Avatar for boondog 76. boondog Lv 1 2 pts. 9,161
  7. Avatar for momadoc 77. momadoc Lv 1 1 pt. 9,146
  8. Avatar for Madis731 78. Madis731 Lv 1 1 pt. 9,137
  9. Avatar for 19477619_Schutte 79. 19477619_Schutte Lv 1 1 pt. 9,123
  10. Avatar for ourtown 80. ourtown Lv 1 1 pt. 9,067

Comments