Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481
  1. Avatar for Arne Heessels 71. Arne Heessels Lv 1 2 pts. 9,217
  2. Avatar for khendarg 72. khendarg Lv 1 2 pts. 9,211
  3. Avatar for SouperGenious 73. SouperGenious Lv 1 2 pts. 9,197
  4. Avatar for marsfan 74. marsfan Lv 1 2 pts. 9,195
  5. Avatar for mitarcher 75. mitarcher Lv 1 2 pts. 9,184
  6. Avatar for boondog 76. boondog Lv 1 2 pts. 9,161
  7. Avatar for momadoc 77. momadoc Lv 1 1 pt. 9,146
  8. Avatar for Madis731 78. Madis731 Lv 1 1 pt. 9,137
  9. Avatar for 19477619_Schutte 79. 19477619_Schutte Lv 1 1 pt. 9,123
  10. Avatar for ourtown 80. ourtown Lv 1 1 pt. 9,067

Comments