Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481

  1. Avatar for Dranon 91. Dranon Lv 1 1 pt. 8,588
  2. Avatar for parsnip 92. parsnip Lv 1 1 pt. 8,571
  3. Avatar for nettieboo 93. nettieboo Lv 1 1 pt. 8,514
  4. Avatar for lamoille 94. lamoille Lv 1 1 pt. 8,493
  5. Avatar for Savas 95. Savas Lv 1 1 pt. 8,481
  6. Avatar for TheStaticSloth 96. TheStaticSloth Lv 1 1 pt. 8,463
  7. Avatar for jamiexq 97. jamiexq Lv 1 1 pt. 8,436
  8. Avatar for alyssa_d 98. alyssa_d Lv 1 1 pt. 8,188
  9. Avatar for Deleted player 99. Deleted player pts. 8,116
  10. Avatar for TY2017 100. TY2017 Lv 1 1 pt. 7,900

Comments