Placeholder image of a protein
Icon representing a puzzle

1511: Unsolved De-novo Freestyle 129

Closed since almost 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 20, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


GRQEKVLKSIEETVRKMGVTMETHRSGNEVKVVIKGLHESQQEQLKKDVEETSKKQGVETRIEFHGDTVTIVVRE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,681
  2. Avatar for Beta Folders 2. Beta Folders 65 pts. 10,672
  3. Avatar for Go Science 3. Go Science 41 pts. 10,560
  4. Avatar for Gargleblasters 4. Gargleblasters 24 pts. 10,537
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,463
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 10,321
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,261
  8. Avatar for Contenders 8. Contenders 2 pts. 9,708
  9. Avatar for Deleted group 9. Deleted group pts. 9,123
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,481

  1. Avatar for Mike Cassidy 31. Mike Cassidy Lv 1 26 pts. 9,999
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 25 pts. 9,988
  3. Avatar for robgee 33. robgee Lv 1 23 pts. 9,963
  4. Avatar for diamonddays 34. diamonddays Lv 1 22 pts. 9,930
  5. Avatar for alwen 35. alwen Lv 1 21 pts. 9,908
  6. Avatar for drumpeter18yrs9yrs 36. drumpeter18yrs9yrs Lv 1 20 pts. 9,873
  7. Avatar for Blipperman 37. Blipperman Lv 1 19 pts. 9,867
  8. Avatar for johnmitch 38. johnmitch Lv 1 18 pts. 9,827
  9. Avatar for TastyMunchies 39. TastyMunchies Lv 1 17 pts. 9,818
  10. Avatar for Glen B 40. Glen B Lv 1 16 pts. 9,816

Comments