Placeholder image of a protein
Icon representing a puzzle

1512: Revisiting Puzzle 61: Designer Protein Top7

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 23, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was designed by the Baker Lab in 2003, and has a topology unlike any natural protein yet discovered. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DIQVQVNIDDNGKNFDYTYTVTTESELQKVLNELMDYIKKQGAKRVRISITARTKKEAEKFAAILIKVFAELGYNDINVTFDGDTVTVEGQL

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 10,656
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,648
  3. Avatar for BCC 13. BCC 1 pt. 10,429
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 9,820
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,500
  6. Avatar for incognito group 16. incognito group 1 pt. 9,075
  1. Avatar for Alistair69 91. Alistair69 Lv 1 1 pt. 10,239
  2. Avatar for cherry39 92. cherry39 Lv 1 1 pt. 10,238
  3. Avatar for Anamfija 93. Anamfija Lv 1 1 pt. 10,220
  4. Avatar for SouperGenious 94. SouperGenious Lv 1 1 pt. 10,207
  5. Avatar for boondog 95. boondog Lv 1 1 pt. 10,200
  6. Avatar for paul567croyden 96. paul567croyden Lv 1 1 pt. 10,158
  7. Avatar for YeshuaLives 97. YeshuaLives Lv 1 1 pt. 10,153
  8. Avatar for cobaltteal 98. cobaltteal Lv 1 1 pt. 10,151
  9. Avatar for TY2017 99. TY2017 Lv 1 1 pt. 10,147
  10. Avatar for Squirrely 100. Squirrely Lv 1 1 pt. 10,131

Comments